PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G052890_P01
Common NameZAG1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MIKC_MADS
Protein Properties Length: 286aa    MW: 32175 Da    PI: 9.6967
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G052890_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.92e-3161110150
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
             SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 
                        krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+
  GRMZM2G052890_P01  61 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 110
                        79***********************************************8 PP

2K-box97.12.6e-321322267100
              K-box   7 ks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                            +e + ++++qe+a+L+++i nLq+++R l+G++++++s+keL++Le++L+k+l kiR+kKn++l++++e++q++e elq++n +Lr++
  GRMZM2G052890_P01 132 AGtIAEVTIQHYKQESARLRQQIVNLQNSNRALIGDSITTMSHKELKHLETRLDKALGKIRAKKNDVLCSEVEYMQRREMELQNDNLYLRSR 223
                        445788899*********************************************************************************99 PP

              K-box  98 lee 100
                        ++e
  GRMZM2G052890_P01 224 VDE 226
                        876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.25453113IPR002100Transcription factor, MADS-box
SMARTSM004321.2E-3853112IPR002100Transcription factor, MADS-box
CDDcd002652.22E-4354127No hitNo description
SuperFamilySSF554554.84E-3254126IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-315575IPR002100Transcription factor, MADS-box
PfamPF003191.2E-2662109IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-317590IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-3190111IPR002100Transcription factor, MADS-box
PfamPF014862.2E-23140224IPR002487Transcription factor, K-box
PROSITE profilePS5129713.642140230IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MHIREEEATP STVTGIMSTL TSAGQQKLKE PISPGGGSAS VAGSAAERNN GGRGKGKTEI  60
KRIENTTNRQ VTFCKRRNGL LKKAYELSVL CDAEVALIVF SSRGRLYEYA NNSVKGTIER  120
YKKATSDNSS AAGTIAEVTI QHYKQESARL RQQIVNLQNS NRALIGDSIT TMSHKELKHL  180
ETRLDKALGK IRAKKNDVLC SEVEYMQRRE MELQNDNLYL RSRVDENERA QQTANMMGAP  240
STSEYQQHGF TPYDPIRSFL QFNIVQQPQF YSQQEDRKDF NDQGGR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-1954134282Myocyte-specific enhancer factor 2B
1tqe_Q1e-1954134282Myocyte-specific enhancer factor 2B
1tqe_R1e-1954134282Myocyte-specific enhancer factor 2B
1tqe_S1e-1954134282Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.1330.0ear| pericarp
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G052890
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G052890_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankMZEZAG1A0.0L18924.1 Corn ZAG1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105321.10.0homologue of Arabidopsis gene AGAMOUS
SwissprotQ2V0P11e-123MAD58_ORYSJ; MADS-box transcription factor 58
TrEMBLQ418760.0Q41876_MAIZE; Uncharacterized protein
STRINGGRMZM2G052890_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.13e-93MIKC_MADS family protein
Publications ? help Back to Top
  1. Schmidt RJ, et al.
    Identification and molecular characterization of ZAG1, the maize homolog of the Arabidopsis floral homeotic gene AGAMOUS.
    Plant Cell, 1993. 5(7): p. 729-37
    [PMID:8103379]